Product Description
Size: 20ul / 150ul
The TP53RK (26818-1-AP) by Proteintech is a Polyclonal antibody targeting TP53RK in WB, IP, IHC, ELISA applications with reactivity to human samples
26818-1-AP targets TP53RK in WB, IP, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Jurkat cells, HepG2 cells
Positive IP detected in: Jurkat cells
Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:400-1:1600
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25326 Product name: Recombinant human TP53RK protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 154-253 aa of BC009727 Sequence: HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG Predict reactive species
Full Name: TP53 regulating kinase
Calculated Molecular Weight: 28 kDa
Observed Molecular Weight: 30 kDa
GenBank Accession Number: BC009727
Gene Symbol: TP53RK
Gene ID (NCBI): 112858
RRID: AB_2880647
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96S44
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924