Proteintech, 26818-1-AP, TP53RK Polyclonal antibody

Size: 20ul / 150ul The TP53RK (26818-1-AP) by Proteintech is a Polyclonal antibody targeting TP53RK in WB, IP, IHC, ELISA applications with reactivity to human samples 26818-1-AP targets TP53RK in WB, IP, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HepG2 cells Positive IP detected in: Jurkat cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25326 Product name: Recombinant human TP53RK protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 154-253 aa of BC009727 Sequence: HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG Predict reactive species Full Name: TP53 regulating kinase Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC009727 Gene Symbol: TP53RK Gene ID (NCBI): 112858 RRID: AB_2880647 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96S44 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.