Iright
BRAND / VENDOR: Proteintech

Proteintech, 26824-1-AP, CPA4 Polyclonal antibody

CATALOG NUMBER: 26824-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CPA4 (26824-1-AP) by Proteintech is a Polyclonal antibody targeting CPA4 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26824-1-AP targets CPA4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, SMMC-7721 cells, mouse kidney tissue, A549 cells, HepG2 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information Carboxypeptidase A4 (CPA4), a member of the metallocarboxypeptidase family, is a zinc-containing exopeptidase that catalyzes the release of carboxy-terminal amino acids. CPA4 was previously shown to play a crucial role in cell growth and differentiation by modulating or inactivating peptide hormone activity (PMID: 27904708). CPA4 expression is increased in multiple cancer tissues, including tissues from patients with pancreatic cancer, gastric cancer, esophageal squamous cell carcinoma, and lung cancer, and may serve as a potential diagnostic and prognostic marker (PMID: 31397502, 32922037). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25327 Product name: Recombinant human CPA4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 316-384 aa of BC052289 Sequence: YPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELR Predict reactive species Full Name: carboxypeptidase A4 Calculated Molecular Weight: 421 aa, 47 kDa Observed Molecular Weight: 44 kDa, 150 kDa GenBank Accession Number: BC052289 Gene Symbol: CPA4 Gene ID (NCBI): 51200 RRID: AB_2880648 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UI42 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924