Proteintech, 26829-1-AP, SUSD4 Polyclonal antibody

Size: 20ul / 150ul The SUSD4 (26829-1-AP) by Proteintech is a Polyclonal antibody targeting SUSD4 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 26829-1-AP targets SUSD4 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MDA-MB-231 cells, TT cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information The SUSD4 (Sushi domain-containing protein 4) gene resides on chromosome 1q41 and encodes a 49-kD transmembrane protein containing four extracellular Sushi domain motifs. The Sushi domain, also known as the complement control protein domain, is commonly involved in protein-protein interactions. Many complement regulators are constructed with complement control protein domains. SUSD4 functions as a complement system regulator, as it has been shown to bind to the C1 complex and complement component C1q and block the activation of the complement cascade by interrupting the formation of C3 convertase. (PMID: 32179479) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25346 Product name: Recombinant human SUSD4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 42-290 aa of BC004888 Sequence: FGPAQLTGGFDDLQVCADPGIPENGFRTPSGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHGEKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRCFPGFKLDGSAYLECLQNLIWSSSPPRCLALEGGRPEHLFPVLYFPHIRLAAAVLYFCPVLKSSPTPAPTCSSTSTTTSLF Predict reactive species Full Name: sushi domain containing 4 Calculated Molecular Weight: 490 aa, 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC004888 Gene Symbol: SUSD4 Gene ID (NCBI): 55061 RRID: AB_3669569 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VX71 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.