Proteintech, 26834-1-AP, ACMSD Polyclonal antibody

Size: 20ul / 150ul The ACMSD (26834-1-AP) by Proteintech is a Polyclonal antibody targeting ACMSD in IHC, ELISA applications with reactivity to human, mouse samples 26834-1-AP targets ACMSD in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ACMSD (alpha-amino-beta-carboxy-muconate-semialdehyde decarboxylase ) is the key enzyme that regulates the de novo NAD+ synthesis from tryptophan. ACMSD is highly expressed in the liver, kidney and to a lower degree in brain under physiological conditions. The enzyme is primarily cytosolic and is positioned at a critical branching point in the kynurenine pathway, wherein it influences the fate of the precursor 2-amino-3-carboxymuconic-6-semialdehyde (ACMS). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25230 Product name: Recombinant human ACMSD protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 47-252 aa of BC016018 Sequence: VSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEE Predict reactive species Full Name: aminocarboxymuconate semialdehyde decarboxylase Calculated Molecular Weight: 38 kDa GenBank Accession Number: BC016018 Gene Symbol: ACMSD Gene ID (NCBI): 130013 RRID: AB_3085909 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDX5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.