Proteintech, 26848-1-AP, CRH/CRF Polyclonal antibody

Size: 20ul / 150ul The CRH/CRF (26848-1-AP) by Proteintech is a Polyclonal antibody targeting CRH/CRF in WB, ELISA applications with reactivity to human, mouse, rat samples 26848-1-AP targets CRH/CRF in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CRH, also called CRF or corticoliberin, is a peptide hormone and neurotransmitter involved in the stress response. Marked reduction in this protein has been observed in association with Alzheimer disease. In addition to production in the hypothalamus, this protein is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. In the placenta it is a marker that determines the length of gestation and the timing of parturition and delivery. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25226 Product name: Recombinant human CRH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 53-156 aa of BC011031 Sequence: SEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERRSEE Predict reactive species Full Name: CRH/CRF Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC011031 Gene Symbol: CRH Gene ID (NCBI): 1392 RRID: AB_3085911 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P06850 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.