Proteintech, 26853-1-AP, UPK1B Polyclonal antibody

Size: 20ul / 150ul The UPK1B (26853-1-AP) by Proteintech is a Polyclonal antibody targeting UPK1B in IHC, ELISA applications with reactivity to human, mouse samples 26853-1-AP targets UPK1B in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human urothelial carcinoma tissue, mouse bladder tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Uroplakins are a group of urothelial differentiation-related membrane proteins. They are components of the asymmetric unit membrane (AUM), which forms the apical plaques of mammalian urothelium and is believed to play a role in strengthening the urothelial apical surface thus preventing the cells from rupturing during bladder distention (PMID: 8175808). Uroplakin-1B (UPK1B) belongs to the tetraspanin (TM4SF) family. UPK1B can promote the proliferation, invasion and metastasis of tumor cells and regulate the development and progression of tumors (PMID: 30229818). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25471 Product name: Recombinant human UPK1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 108-229 aa of BC063568 Sequence: TAATQRDFFTPNLFLKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNRH Predict reactive species Full Name: uroplakin 1B GenBank Accession Number: BC063568 Gene Symbol: UPK1B Gene ID (NCBI): 7348 RRID: AB_3085912 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75841 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.