Iright
BRAND / VENDOR: Proteintech

Proteintech, 26864-1-AP, SLC7A11/xCT Polyclonal antibody

CATALOG NUMBER: 26864-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC7A11/xCT (26864-1-AP) by Proteintech is a Polyclonal antibody targeting SLC7A11/xCT in WB, IHC, IP, ELISA applications with reactivity to human samples 26864-1-AP targets SLC7A11/xCT in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: unboiled HeLa cells, HeLa cells, HepG2 cells, unboiled HepG2 cells Positive IP detected in: HeLa cells, A549 cells, HepG2 cells Positive IHC detected in: human renal cell carcinoma tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC7A11 (also known as xCT) is a membrane transporter involved in the uptake of cystine. It promotes glutathione synthesis through the uptake of cystine and the concomitant release of glutamate. This, in turn, protects cells from oxidative stress, maintains cellular redox balance, and prevents cell death induced by lipid peroxidation. SLC7A11 has been identified as a potential target for cancer therapeutics. It is overexpressed in multiple malignant tumors and is closely associated with the growth, prognosis, metastasis, and treatment response of various cancers including lung cancer. The SLC7A11 protein appears at two molecular weights, 55 kDa and 35 kDa, and the 55 kDa protein is ubiquitinated(PMID: 32188872). 26864-1-AP recognizes the 35-40 kDa protein similar to the paper published (PMID: 36747082). Specification Tested Reactivity: human Cited Reactivity: human, chicken, bovine, sheep, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25431 Product name: Recombinant human SLC7A11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-42 aa of BC012087 Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKR Predict reactive species Full Name: solute carrier family 7, (cationic amino acid transporter, y+ system) member 11 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC012087 Gene Symbol: SLC7A11 Gene ID (NCBI): 23657 RRID: AB_2880661 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPY5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924