Iright
BRAND / VENDOR: Proteintech

Proteintech, 26881-1-AP, HGF Polyclonal antibody

CATALOG NUMBER: 26881-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HGF (26881-1-AP) by Proteintech is a Polyclonal antibody targeting HGF in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 26881-1-AP targets HGF in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, A-204 cells, JAR cells, HepG2 cells, NCI-H1299 cells, U-87 MG cells, human placenta tissue Positive IHC detected in: human liver cancer tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Hepatocyte growth factor (HGF) is the most potent mitogen of mature hepatocytes in primary culture. HGF is derived from a biologically inactive single chain precursor of 728 amino acids (pro-HGF) localized mostly on the cell surface and in the extracellular matrix. The mature form produced following proteolytic cleavage is composed of a 69-kDa α-subunit (containing four kringle domains) and the 34 kDa β-subunit, similar to the catalytic domain of serine proteases, but with amino acid substitutions in the active site. HGF is a pleiotropic cytokine which exerts a variety of effects on several cells, being involved in the regulation of many biological processes, such as inflammation, tissue repair, morphogenesis, angiogenesis, tumour propagation, immunomodulation of viral infections and cardio-metabolic activities. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25456 Product name: Recombinant human HGF protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 118-157 aa of BC130286 Sequence: LYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP Predict reactive species Full Name: hepatocyte growth factor (hepapoietin A; scatter factor) Observed Molecular Weight: 69 kDa GenBank Accession Number: BC130286 Gene Symbol: HGF Gene ID (NCBI): 3082 RRID: AB_2880668 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14210 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924