Proteintech, 26883-1-AP, SLC4A3 Polyclonal antibody

Size: 20ul / 150ul The SLC4A3 (26883-1-AP) by Proteintech is a Polyclonal antibody targeting SLC4A3 in WB, ELISA applications with reactivity to human, mouse samples 26883-1-AP targets SLC4A3 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25457 Product name: Recombinant human SLC4A3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 429-499 aa of BC146656 Sequence: NDDKDSGFFPRNPSSSSMNSVLGNHHPTPSHGPDGAVPTMADDLGEPAPLWPHDPDAKEKPLHMPGGDGHR Predict reactive species Full Name: solute carrier family 4, anion exchanger, member 3 Calculated Molecular Weight: 1232 aa, 136 kDa Observed Molecular Weight: 135-140 kDa,104 kDa GenBank Accession Number: BC146656 Gene Symbol: SLC4A3 Gene ID (NCBI): 6508 RRID: AB_2918114 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48751 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.