Product Description
Size: 20ul / 150ul
The SCAMP3 (26888-1-AP) by Proteintech is a Polyclonal antibody targeting SCAMP3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples
26888-1-AP targets SCAMP3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HuH-7 cells, A549 cells, K-562 cells
Positive IP detected in: HepG2 cells, mouse heart tissue
Positive IHC detected in: mouse skeletal muscle tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:3000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25256 Product name: Recombinant human SCAMP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-96 aa of BC000161 Sequence: MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT Predict reactive species
Full Name: secretory carrier membrane protein 3
Calculated Molecular Weight: 38 kDa
Observed Molecular Weight: 33 kDa
GenBank Accession Number: BC000161
Gene Symbol: SCAMP3
Gene ID (NCBI): 10067
RRID: AB_2810962
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O14828
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924