Proteintech, 26892-1-AP, GNG3 Polyclonal antibody

Size: 20ul / 150ul The GNG3 (26892-1-AP) by Proteintech is a Polyclonal antibody targeting GNG3 in WB, ELISA applications with reactivity to Mouse, Rat samples 26892-1-AP targets GNG3 in WB, ELISA applications and shows reactivity with Mouse, Rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information GNG3, also named as GNGT3, belongs to the G protein gamma family. G proteins are heterotrimers of alpha, beta, and gamma subunits. Gamma subunits, such as GNG3, contribute to the specificity of the hundreds of receptor signaling pathways involving G proteins. GNG3 is predominantly expressed in the brain, where its expression increases during postnatal development. Specification Tested Reactivity: Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25341 Product name: Recombinant human GNG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC015563 Sequence: MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPT Predict reactive species Full Name: guanine nucleotide binding protein (G protein), gamma 3 Calculated Molecular Weight: 8 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC015563 Gene Symbol: GNG3 Gene ID (NCBI): 2785 RRID: AB_3085915 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P63215 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.