Proteintech, 26894-1-AP, DDX54 Polyclonal antibody

Size: 20ul / 150ul The DDX54 (26894-1-AP) by Proteintech is a Polyclonal antibody targeting DDX54 in WB, IF/ICC, ELISA applications with reactivity to human samples 26894-1-AP targets DDX54 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DDX54, also named as ATP-dependent RNA helicase DDX54, is a 881 amino acid protein, which contains 1 helicase ATP-binding domain and belongs to the DEAD box helicase family. DDX54/DBP10 subfamily. DDX54 localizes in nucleus and Interacts in a hormone-dependent manner with nuclear receptors. DDX54 has RNA-dependent ATPase activity and represses the transcriptional activity of nuclear receptors. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25289 Product name: Recombinant human DDX54 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 778-881 aa of BC156669 Sequence: DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 Calculated Molecular Weight: 98 kDa Observed Molecular Weight: 98 kDa GenBank Accession Number: BC156669 Gene Symbol: DDX54 Gene ID (NCBI): 79039 RRID: AB_2880671 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDD1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.