Proteintech, 26897-1-AP, HNRNPM Polyclonal antibody

Size: 20ul / 150ul The HNRNPM (26897-1-AP) by Proteintech is a Polyclonal antibody targeting HNRNPM in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 26897-1-AP targets HNRNPM in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, MCF-7 cells, HeLa cells, NIH/3T3 cells, Neuro-2a cells Positive IP detected in: HEK-293T cells Positive IHC detected in: human tonsillitis tissue, human colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information HNRNPM, also named as NAGR1, is a 730 amino acid protein, which localizes in nucleus. HNRNPM as a pre-mRNA binding protein in vivo, binds avidly to poly(G) and poly(U) RNA homopolymers in vitro. HNRNPM is Involved in splicing. HNRNPM acts as a receptor for carcinoembryonic antigen in Kupffer cells, may initiate a series of signaling events leading to tyrosine phosphorylation of proteins and induction of IL-1 alpha, IL-6, IL-10 and tumor necrosis factor alpha cytokines. HNRNPM exists two isoforms with MV 77 kDa and 73 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25474 Product name: Recombinant human HNRNPM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-93 aa of BC000138 Sequence: MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKE Predict reactive species Full Name: heterogeneous nuclear ribonucleoprotein M Calculated Molecular Weight: 78 kDa Observed Molecular Weight: 73-77 kDa GenBank Accession Number: BC000138 Gene Symbol: HNRNPM Gene ID (NCBI): 4670 RRID: AB_2880673 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P52272 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.