Proteintech, 26905-1-AP, Neuronatin Polyclonal antibody

Size: 20ul / 150ul The Neuronatin (26905-1-AP) by Proteintech is a Polyclonal antibody targeting Neuronatin in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 26905-1-AP targets Neuronatin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: fetal human brain tissue, SH-SY5Y cells Positive IHC detected in: human pituitary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25408 Product name: Recombinant human NNAT protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 40-81 aa of BC001768 Sequence: NPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN Predict reactive species Full Name: neuronatin Calculated Molecular Weight: 9 kDa Observed Molecular Weight: 9 kDa GenBank Accession Number: BC001768 Gene Symbol: NNAT Gene ID (NCBI): 4826 RRID: AB_2880678 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16517 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.