Proteintech, 26913-1-AP, CSGALNACT1 Polyclonal antibody

Size: 20ul / 150ul The CSGALNACT1 (26913-1-AP) by Proteintech is a Polyclonal antibody targeting CSGALNACT1 in WB, IP, ELISA applications with reactivity to human samples 26913-1-AP targets CSGALNACT1 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, MCF-7 cells Positive IP detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information CSGalNAcT-1 (chondroitin sulfate N-acetylgalactosaminyltransferase-1), catalyzing the transfer of a GalNAc residue onto the nonreducing end of GlcA, is a key glycosyltransferase for chondroitin sulfate (CS) biosynthesis in cartilage. Abnormal expression of CSGalNAcT-1 in cartilage has been linked to diseases like osteoarthritis. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25455 Product name: Recombinant human CSGALNACT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 89-149 aa of BC060772 Sequence: RSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQVDKAEVNAGVKLATEYAAVPFD Predict reactive species Full Name: chondroitin sulfate N-acetylgalactosaminyltransferase 1 Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 61-68 kDa GenBank Accession Number: BC060772 Gene Symbol: CSGALNACT1 Gene ID (NCBI): 55790 RRID: AB_2880682 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDX6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.