Proteintech, 26915-1-AP, VEGFD Polyclonal antibody

Size: 20ul / 150ul The VEGFD (26915-1-AP) by Proteintech is a Polyclonal antibody targeting VEGFD in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 26915-1-AP targets VEGFD in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, MCF-7 cells, rat heart tissue Positive IHC detected in: human lung cancer tissue, human heart tissue, human thyroid cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information VEGFD is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a complex proteolytic maturation, generating multiple processed forms which bind and activate VEGFR-2 and VEGFR-3 receptors. This protein is structurally and functionally similar to vascular endothelial growth factor C. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25552 Product name: Recombinant human FIGF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-128 aa of BC027948 Sequence: AATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKST Predict reactive species Full Name: c-fos induced growth factor (vascular endothelial growth factor D) Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC027948 Gene Symbol: FIGF Gene ID (NCBI): 2277 RRID: AB_2880683 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43915 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.