Proteintech, 26917-1-AP, TRAF5 Polyclonal antibody

Size: 20ul / 150ul The TRAF5 (26917-1-AP) by Proteintech is a Polyclonal antibody targeting TRAF5 in WB, ELISA applications with reactivity to human samples 26917-1-AP targets TRAF5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TRAF5 (also known as TNF receptor-associated factor 5, Ring finger protein 84, RNF8, MGC:39780) is a member of the tumor necrosis factor receptor-associated (TRAF) family of proteins that are characterized by the presence of a meprin and TRAF homology (MATH) domain, a RING-type zinc finger domain, and two TRAF-type zinc finger domains (https://www.uniprot.org/uniprot/O00463). TRAF5 is a scaffold protein that associates with and mediates signal transduction by cell surface receptors belonging to the tumor necrosis factor (TNF) superfamily, including CD27, CD30, CD40, and lymphotoxin-β receptor, positively regulating activation of the canonical NF-κB pathway and c-Jun NH2-terminal kinase (JNK) activation by these receptors (PMIDs: 8999898, 9582383, 8790348, 8663299).The RING-type zinc finger domain of TRAF5 exhibits ubiquitin protein ligase activity and is responsible for Lys-63-linked polyubiquitination of protein targets (PMIDs:23758787,29176576). This domain has been demonstrated to be required for TRAF5-mediated activation of NF-κB (PMID:8663299).What is the molecular weight of TRAF5?TRAF5 is a 557 amino acid protein that has a predicted molecular weight of 64 kDa.What is the subcellular localization of TRAF-5?TRAF5 is a cytoplasmic protein (PMID:11607847).What is the tissue specificity of TRAF5?TRAF5 is broadly expressed in the spleen, thymus, prostate, testis, ovary, small intestine, colon, and peripheral blood. The highest level of expression is observed in Peyer's patches in the small intestine (https://www.uniprot.org/uniprot/O00463).What is the role of TRAF5 and immune cell function?Studies in traf5-/- mice have shown that TRAF5 plays a key role in CD40-mediated signaling in B-cells and CD27-mediated signaling in T-cells. In B-cells, deletion of the traf5 gene results in defects in cell proliferation and upregulation of various cell surface molecules, including CD23, CD54, CD80, CD86, and Fas, in response to CD40 stimulation. Similarly, upregulation of CD27-mediated costimulatory signals is also impaired in traf5−/− T cells. These effects lead to impairments in lymphocyte activation in vivo (PMID:10449775).TRAF5 also plays a critical role in in vitro signaling and in vivo function in B-cells by the Epstein-Barr Virus (EBV)-encoded oncogenic mimic of CD40, latent membrane protein 1 (LMP1), which is encoded by the virus and is essential for transformation of B lymphocytes (PMID:19805155). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25284 Product name: Recombinant human TRAF5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC029600 Sequence: MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGC Predict reactive species Full Name: TNF receptor-associated factor 5 Calculated Molecular Weight: 557 aa, 64 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC029600 Gene Symbol: TRAF5 Gene ID (NCBI): 7188 RRID: AB_2880684 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00463 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.