Iright
BRAND / VENDOR: Proteintech

Proteintech, 26932-1-AP, LMO1 Polyclonal antibody

CATALOG NUMBER: 26932-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LMO1 (26932-1-AP) by Proteintech is a Polyclonal antibody targeting LMO1 in WB, ELISA applications with reactivity to human, mouse, rat samples 26932-1-AP targets LMO1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information LOM1 (LIM Domain Only 1), as a Protein Coding gene, encodes a cysteine-rich, two LIM domain transcriptional regulator. It may be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors. A chromosomal aberration involving LMO1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL)(Uniprot). Diseases associated with LMO1 include T-Cell Acute Lymphoblastic Leukemia and Neuroblastoma (PMID:31830377). The downstream of LMO1-regulatory cascade includes a tumor-promoting LIMS1/ILK pathway, which has a potential to be a novel therapeutic target(PMID: 29695398). The molecular weight of LMO1 is 18 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25607 Product name: Recombinant human LMO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 11-83 aa of BC069793 Sequence: PMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFG Predict reactive species Full Name: LIM domain only 1 (rhombotin 1) Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC069793 Gene Symbol: LMO1 Gene ID (NCBI): 4004 RRID: AB_3085916 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P25800 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924