Proteintech, 26934-1-AP, ANGPTL1 Polyclonal antibody

Size: 20ul / 150ul The ANGPTL1 (26934-1-AP) by Proteintech is a Polyclonal antibody targeting ANGPTL1 in WB, ELISA applications with reactivity to human, mouse, rat samples 26934-1-AP targets ANGPTL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, MCF-7 cells, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Angiopoietin-related protein 1 (ANGPTL1) also known as angiopoietin-3 (ANG-3), is a secreted glycoprotein that structurally resembles angiogenin and is involved in the regulation of angiogenesis. ANGPTL1 is down-regulated in various cancers, including colorectal cancer (CRC), and its expression is inversely correlated with metastasis and poor clinical outcomes. ANGPTL1 has been shown to suppress angiogenesis, cancer invasion, metastasis, and cancer progression. The predicted molecular weight of ANGPTL1 is 57 kDa, but the literature reports that the detected molecular weight of ANGPTL1 is around 68 kDa (PMID: 15284220 ). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25529 Product name: Recombinant human ANGPTL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 158-315 aa of BC050640 Sequence: ILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDP Predict reactive species Full Name: angiopoietin-like 1 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 64-70 kDa GenBank Accession Number: BC050640 Gene Symbol: ANGPTL1 Gene ID (NCBI): 9068 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95841 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.