Iright
BRAND / VENDOR: Proteintech

Proteintech, 26940-1-AP, PDGFA Polyclonal antibody

CATALOG NUMBER: 26940-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PDGFA (26940-1-AP) by Proteintech is a Polyclonal antibody targeting PDGFA in WB, ELISA applications with reactivity to human, mouse, rat samples 26940-1-AP targets PDGFA in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat kidney tissue, mouse kidney tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information PDGFA is a member of the platelet-derived growth factor family. Four members of this family are mitogenic factors for cells of mesenchymal origin, and they are characterized by a motif of eight cysteines. PDGFA plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, and chemotaxis. It is also required for normal lung alveolar septum formation during embryogenesis, development of the gastrointestinal tract, and spermatogenesis. PDGFA is also involved in oligodendrocyte development and the myelination process in the spinal cord and cerebellum. PDGF-A protein monomer is about 13-16 kDa, and PDGF-AA is a 28.5 kDa A chain homodimer. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25643 Product name: Recombinant human PDGFA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 135-196 aa of BC146594 Sequence: TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR Predict reactive species Full Name: platelet-derived growth factor alpha polypeptide Calculated Molecular Weight: 196 aa, 22 kDa Observed Molecular Weight: 13-16 kDa GenBank Accession Number: BC146594 Gene Symbol: PDGFA Gene ID (NCBI): 5154 RRID: AB_3669576 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04085 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924