Proteintech, 26949-1-AP, FCRLA Polyclonal antibody

Size: 20ul / 150ul The FCRLA (26949-1-AP) by Proteintech is a Polyclonal antibody targeting FCRLA in WB, IHC, ELISA applications with reactivity to human samples 26949-1-AP targets FCRLA in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, Daudi cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25331 Product name: Recombinant human FCRLA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 275-376 aa of BC006521 Sequence: IRVQGASSSAAPPTLNPAPQKSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHQKPGTTKATAE Predict reactive species Full Name: Fc receptor-like A Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 39-43 kDa GenBank Accession Number: BC006521 Gene Symbol: FCRLA Gene ID (NCBI): 84824 RRID: AB_2880697 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L513 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.