Product Description
Size: 20ul / 150ul
The GNRH1 (26950-1-AP) by Proteintech is a Polyclonal antibody targeting GNRH1 in IHC, ELISA applications with reactivity to human, mouse, rat samples
26950-1-AP targets GNRH1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive IHC detected in: human brain tissue, mouse brain tissue, rat brain tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:200-1:800
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse, rat, pig
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25667 Product name: Recombinant human GNRH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-92 aa of BC126463 Sequence: QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI Predict reactive species
Full Name: gonadotropin-releasing hormone 1 (luteinizing-releasing hormone)
Calculated Molecular Weight: 92 aa, 10 kDa
GenBank Accession Number: BC126463
Gene Symbol: GNRH1
Gene ID (NCBI): 2796
RRID: AB_2880698
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P01148
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924