Product Description
Size: 20ul / 150ul
The RYR1 (26968-1-AP) by Proteintech is a Polyclonal antibody targeting RYR1 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples
26968-1-AP targets RYR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive IHC detected in: mouse brain tissue, human cerebellum tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse cerebellum tissue, mouse brain tissue
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)-P: IF-P : 1:50-1:500
Background Information
Ryanodine receptor isoform-1 (RyR1) is a major calcium channel in skeletal muscle important for excitation-contraction coupling. The transmembrane region of RyR1 is comprised of two domains including the pseudo voltage sensor domain and the pore-forming domain (PMID: 27855725). Dominant RyR1 mutations are the leading cause of MH. Studies on the Ca2+ conducting properties of RyR1 channels containing Malignant hyperthermia mutations expressed in myotubes.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: mouse, rat, chicken
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25120 Product name: Recombinant human RYR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4942-5038 aa of NM_000540 Sequence: GELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS Predict reactive species
Full Name: ryanodine receptor 1 (skeletal)
Calculated Molecular Weight: 565 kDa
GenBank Accession Number: NM_000540
Gene Symbol: RYR1
Gene ID (NCBI): 6261
RRID: AB_2880703
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P21817
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924