Proteintech, 26970-1-AP, CCNYL1 Polyclonal antibody

Size: 20ul / 150ul The CCNYL1 (26970-1-AP) by Proteintech is a Polyclonal antibody targeting CCNYL1 in WB, ELISA applications with reactivity to human samples 26970-1-AP targets CCNYL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: fetal human brain tissue, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25583 Product name: Recombinant human CCNYL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC067253 Sequence: MPEDLALESNPSDHPRASTIFLSKSQTDVREKRKSNHLNHCDLSNILPHKEQREKVPEEYFK Predict reactive species Full Name: cyclin Y-like 1 Calculated Molecular Weight: 238 aa, 28 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC067253 Gene Symbol: CCNYL1 Gene ID (NCBI): 151195 RRID: AB_2880704 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N7R7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.