Proteintech, 26994-1-AP, TCTEX1D2 Polyclonal antibody

Size: 20ul / 150ul The TCTEX1D2 (26994-1-AP) by Proteintech is a Polyclonal antibody targeting TCTEX1D2 in WB, ELISA applications with reactivity to human, mouse, rat samples 26994-1-AP targets TCTEX1D2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information DYNLT2B also known as TCTEX1D2, belongs to the dynein family and is required for proper retrograde ciliary transport(PMID: 29742051). TCTEX1D2 functions as a light chain that appears to stabilize the retrograde IFT dynein complex. Mutations in TCTEX1D2 are associated with Short-rib thoracic dysplasia 17 with or without polydactyly (SRTD17)( PMID: 26044572). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25770 Product name: Recombinant human TCTEX1D2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC021177 Sequence: MATSIGVSFSVGDGVPEAEKNAGEPENTYILRPVFQQRFRPSVVKDCIHAVLKEGLANAEYSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDADTDNYTHDVFMNDSLFCVVAAFGCFYY Predict reactive species Full Name: Tctex1 domain containing 2 Observed Molecular Weight: 16 kDa GenBank Accession Number: BC021177 Gene Symbol: TCTEX1D2 Gene ID (NCBI): 255758 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WW35 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.