Proteintech, 26997-1-AP, RASGRP1 Polyclonal antibody

Size: 20ul / 150ul The RASGRP1 (26997-1-AP) by Proteintech is a Polyclonal antibody targeting RASGRP1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 26997-1-AP targets RASGRP1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RASGRP1 (RAS guanyl-releasing protein 1) is a Ras guanine nucleotide exchange factor, and an essential regulator of lymphocyte receptor signaling (PMID: 33065764). RasGRP1 is a bifunctional regulator that promotes acute inflammation and inhibits inflammation-associated cancer (PMID: 36385095). RasGRP1, a downstream target gene of VEGF, regulates the development, homeostasis, and differentiation of T cells (PMID: 37429143). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25725 Product name: Recombinant human RASGRP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 678-797 aa of BC109297 Sequence: QPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS Predict reactive species Full Name: RAS guanyl releasing protein 1 (calcium and DAG-regulated) Calculated Molecular Weight: 797 aa, 90 kDa Observed Molecular Weight: 85-90 kDa GenBank Accession Number: BC109297 Gene Symbol: RASGRP1 Gene ID (NCBI): 10125 RRID: AB_3669579 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95267 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.