Iright
BRAND / VENDOR: Proteintech

Proteintech, 26999-1-AP, CITED1 Polyclonal antibody

CATALOG NUMBER: 26999-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CITED1 (26999-1-AP) by Proteintech is a Polyclonal antibody targeting CITED1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 26999-1-AP targets CITED1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat testis tissue, A375 cells, mouse testis tissue Positive IP detected in: A375 cells Positive IHC detected in: human colon cancer tissue, human thyroid cancer tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Positive FC (Intra) detected in: HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information CITED1, also named as MSG1, belongs to the CITED family. CITED1 is a bifunctional transcriptional cofactor which is able to activate or repress transcription in association with other transcription factors. The CITED1 gene encodes a 27 kDa protein, but a 30 kDa band was also detected in the publication. The elevation of CITED1 may be directly associated with the preneoplastic phenotype (PMID: 23935526, 15272279, 15843474). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rabbit Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24643 Product name: Recombinant human CITED1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-151 aa of BC004240 Sequence: MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSD Predict reactive species Full Name: Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC004240 Gene Symbol: CITED1 Gene ID (NCBI): 4435 RRID: AB_2880718 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99966 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924