Iright
BRAND / VENDOR: Proteintech

Proteintech, 27002-1-AP, HOXC13 Polyclonal antibody

CATALOG NUMBER: 27002-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HOXC13 (27002-1-AP) by Proteintech is a Polyclonal antibody targeting HOXC13 in WB, IF/ICC, ELISA applications with reactivity to human samples 27002-1-AP targets HOXC13 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, NCCIT cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HOXC13 is a member of HOX proteins. The HOX family includes 39 paralogous proteins expressed from the HOXA, HOXB, HOXC, and HOXD gene clusters, and these function early in embryonic development to establish cell and tissue identity and to regulate cell proliferation, differentiation, and survival (PMID: 30974835). Human HOXC13, which is expressed in the hair follicle and nail matrix, is involved in the regulation of keratin gene expression (PMID: 11714694). Mutations in human HOXC13 cause ectodermal dysplasia 9, a severe defect of hair and nails (PMID: 23063621). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25544 Product name: Recombinant human HOXC13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC090850 Sequence: MTTSLLLHPRWPESLMYVYEDSAAESGIGGGGGGGGGGTGGAGGGCSGASPGKAPSMDGLGSSCPASHCRDLLPHPVLGRPPAPLGAPQGAVYTDIPAPEAARQCAPPPAPPTSSSATLGYGYPFGGSYYGCRLSHNVNLQQKPCAYHPGDKYPEPSGALPGDDL Predict reactive species Full Name: homeobox C13 Calculated Molecular Weight: 35 kDa, 330 aa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC090850 Gene Symbol: HOXC13 Gene ID (NCBI): 3229 RRID: AB_3669580 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31276 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924