Product Description
Size: 20ul / 150ul
The PRPS2 (27024-1-AP) by Proteintech is a Polyclonal antibody targeting PRPS2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples
27024-1-AP targets PRPS2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: A375 cells
Positive IP detected in: A375 cells, mouse spleen tissue
Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: A375 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
PRPS (phosphoribosyl pyrophosphate synthetase) proteins catalyze the synthesis of phosphoribosyl pyrophosphate (PRPP). Three human PRPS isoforms exist and are encoded by three different genes. PRPS1 and PRPS2 (also known as PRS1 and PRS2, respectively) are ubiquitously expressed, while PRPS3 (also known as PRPS1L1) is specific to the testis. PRPP is an important substrate synthesized from MgATP and ribose-5-phosphate in a reaction that requires inorganic phosphate and magnesium as a cofactor. PRPP is essential in the synthesis of nearly all nucleotides, implying that PRPS proteins play an important role in nucleotide biosynthesis and purine metabolism. PRPS2 is a 318 amino acid protein that exists as a homodimer and a hexamer composed of three homodimers.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25785 Product name: Recombinant human PRPS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 143-273 aa of BC119662 Sequence: IPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVV Predict reactive species
Full Name: phosphoribosyl pyrophosphate synthetase 2
Observed Molecular Weight: 30-34 kDa
GenBank Accession Number: BC119662
Gene Symbol: PRPS2
Gene ID (NCBI): 5634
RRID: AB_2880726
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P11908
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924