Iright
BRAND / VENDOR: Proteintech

Proteintech, 27031-1-AP, CEP57 Polyclonal antibody

CATALOG NUMBER: 27031-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CEP57 (27031-1-AP) by Proteintech is a Polyclonal antibody targeting CEP57 in WB, ELISA applications with reactivity to human samples 27031-1-AP targets CEP57 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Cep57 is an ubiquitously-expressed protein that functions in spindle assembly, spindle pole integrity and central spindle organization as a microtubule- and centrosome-associated protein. Also, Cep57 is required for centriole duplication, and is highly expressed in prostate cancer cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24885 Product name: Recombinant human CEP57 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 241-500 aa of BC001233 Sequence: NRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPSHAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQLLKDMQSIQNSLQSSSLCWDY Predict reactive species Full Name: centrosomal protein 57kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC001233 Gene Symbol: CEP57 Gene ID (NCBI): 9702 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86XR8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924