Iright
BRAND / VENDOR: Proteintech

Proteintech, 27048-1-AP, SYS1 Polyclonal antibody

CATALOG NUMBER: 27048-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SYS1 (27048-1-AP) by Proteintech is a Polyclonal antibody targeting SYS1 in IHC, ELISA applications with reactivity to human samples 27048-1-AP targets SYS1 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SYS1 forms a complex with ADP-ribosylation factor-related protein-1 (ARFRP1; 604699) and targets ARFRP1 to the Golgi apparatus(PMID: 15077113). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24719 Product name: Recombinant human SYS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC048286 Sequence: MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFSTPPGRLSMMSFILNALT Predict reactive species Full Name: SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae) Calculated Molecular Weight: 156 aa, 18 kDa GenBank Accession Number: BC048286 Gene Symbol: SYS1 Gene ID (NCBI): 90196 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N2H4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924