Iright
BRAND / VENDOR: Proteintech

Proteintech, 27049-1-AP, XKRX Polyclonal antibody

CATALOG NUMBER: 27049-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The XKRX (27049-1-AP) by Proteintech is a Polyclonal antibody targeting XKRX in WB, IHC, ELISA applications with reactivity to human samples 27049-1-AP targets XKRX in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information XKRX (XK-associated X-linked protein) is a component of the XK/Kell complex in the Kell blood group system, encoding a membrane protein with multiple transmembrane domains that is exposed on the cell surface and may function as a membrane transport protein. It is expressed predominantly in the placenta and syncytiotrophoblasts. It has 2 isoforms, with molecular weights of 52 kDa and 28 kDa respectively. Its function has not been fully clarified yet. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25266 Product name: Recombinant human XKRX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-210 aa of BC137010 Sequence: VHRDLAKDKPLSLFMHLILLGPVIRCLEAMIKYLTLWKKEEQEEPYVSLTRKKMLIDGEEVLIEWEVGHSIRTLAMHRNAYKRMSQIQAFLGSVPQLTYQLYVSLISAEV Predict reactive species Full Name: XK, Kell blood group complex subunit-related, X-linked Calculated Molecular Weight: 462 aa, 54 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC137010 Gene Symbol: XKRX Gene ID (NCBI): 402415 RRID: AB_2880732 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PP77 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924