Proteintech, 27055-1-AP, Cytokeratin 73 Polyclonal antibody

Size: 20ul / 150ul The Cytokeratin 73 (27055-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 73 in WB, ELISA applications with reactivity to human, rat samples 27055-1-AP targets Cytokeratin 73 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat skin tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes a protein that is expressed in the inner root sheath of hair follicles. The type II keratins are clustered in a region of chromosome 12q13. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25716 Product name: Recombinant human KRT73 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-45 aa of BC109212 Sequence: MSRQFTYKSGPAAKGGFSGCSAVLSGGSSSSYRAGGKGLSGGFSS Predict reactive species Full Name: keratin 73 Observed Molecular Weight: 59 kDa GenBank Accession Number: BC109212 Gene Symbol: KRT73 Gene ID (NCBI): 319101 RRID: AB_3085921 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86Y46 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.