Proteintech, 27057-1-AP, XAF1 Polyclonal antibody

Size: 20ul / 150ul The XAF1 (27057-1-AP) by Proteintech is a Polyclonal antibody targeting XAF1 in WB, IP, ELISA applications with reactivity to human samples 27057-1-AP targets XAF1 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, IFN alpha treated treated Jurkat cells Positive IP detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information XIAP-associated factor 1 (XAF1) is also named as BIRC4BP (BIRC4-binding protein) and XIAPAF1. XAF1 was originally identified as an antagonist of XIAP counteracting its anti-caspase activity by inhibiting the RING domain of XIAP. XAF1is also concerned with IFN-induced apoptosis (PMID: 35972291). XAF1 plays a key role in the communication between IRF1-mediated early immune responses and IRF3-mediated late IFN-dependent immune responses (PMID: 37595039). XAF1 as a direct interacting protein of AKT1, which strongly binds the N-terminal region of AKT1 to block its K63-linked poly-ubiquitination and subsequent activation (PMID: 37384528). XAF1 may serve as an osteoprotective regulator to restore bone homeostasis (PMID: 38957269). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25843 Product name: Recombinant human XAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 254-301 aa of BC073156 Sequence: PRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNFS Predict reactive species Full Name: XIAP associated factor 1 Calculated Molecular Weight: 301 aa, 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC073156 Gene Symbol: XAF1 Gene ID (NCBI): 54739 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6GPH4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.