Product Description
Size: 20ul / 150ul
The CDK5R2/p39 (27058-1-AP) by Proteintech is a Polyclonal antibody targeting CDK5R2/p39 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
27058-1-AP targets CDK5R2/p39 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: Neuro-2a cells, mouse brain tissue, rat brain tissue
Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
CDK5R2 is a neuron-specific activator of CDK5 kinase. It associates with CDK5 to form an active kinase. This protein and neuron-specific CDK5 activator CDK5R1/p39NCK5A both share limited similarity to cyclins, and thus may define a distinct family of cyclin-dependent kinase activating proteins.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25834 Product name: Recombinant human CDK5R2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 9-75 aa of BC041771 Sequence: PASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVLISALTWRRLVAASAK Predict reactive species
Full Name: cyclin-dependent kinase 5, regulatory subunit 2 (p39)
Observed Molecular Weight: 39 kDa
GenBank Accession Number: BC041771
Gene Symbol: CDK5R2/p39
Gene ID (NCBI): 8941
RRID: AB_2880735
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q13319
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924