Proteintech, 27068-1-AP, FGD2 Polyclonal antibody

Size: 20ul / 150ul The FGD2 (27068-1-AP) by Proteintech is a Polyclonal antibody targeting FGD2 in WB, IHC, ELISA applications with reactivity to human samples 27068-1-AP targets FGD2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells Positive IHC detected in: human tonsillitis tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FGD2 is a member of the formin family of proteins, which are known for their role in regulating the assembly of actin filaments. Formins are characterized by their ability to nucleate and elongate actin filaments, and they play a crucial role in processes that require dynamic actin structures, such as cell motility and cell division. Mutations or alterations in FGD2 have been associated with certain developmental disorders and diseases. For example, mutations in FGD2 are a cause of faciogenital dysplasia (Aarskog-Scott syndrome), a condition characterized by facial and genital abnormalities and short stature. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25782 Product name: Recombinant human FGD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of BC023645 Sequence: MKGASEEKLASVSNLVTVFENSRTPEAAPRGHRLEDVHHRPECRPPESPGPREKTNVGEAVGSEPRTVSRRYLNSLKNKLSSEAWRKSCQPVTLSGSGTQEPEKKIVQELLETEQAYVARLHL Predict reactive species Full Name: FYVE, RhoGEF and PH domain containing 2 Calculated Molecular Weight: 655 aa, 75 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC023645 Gene Symbol: FGD2 Gene ID (NCBI): 221472 RRID: AB_2880740 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z6J4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.