Proteintech, 27079-1-AP, Growth Hormone Polyclonal antibody

Size: 20ul / 150ul The Growth Hormone (27079-1-AP) by Proteintech is a Polyclonal antibody targeting Growth Hormone in WB, IHC, ELISA applications with reactivity to human samples 27079-1-AP targets Growth Hormone in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Positive IHC detected in: human pituitary adenoma tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GH1, also named as GH or GH-N, belongs to the somatotropin/prolactin family. GH1 plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22841 Product name: Recombinant human GH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-98 aa of BC075012 Sequence: LPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSN Predict reactive species Full Name: GH1 Calculated Molecular Weight: 217 aa, 25 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC075012 Gene Symbol: GH1 Gene ID (NCBI): 2688 RRID: AB_2880745 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01241 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.