Iright
BRAND / VENDOR: Proteintech

Proteintech, 27094-1-AP, RAB10 Polyclonal antibody

CATALOG NUMBER: 27094-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RAB10 (27094-1-AP) by Proteintech is a Polyclonal antibody targeting RAB10 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, canine samples 27094-1-AP targets RAB10 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, canine samples. Tested Applications Positive WB detected in: MCF-7 cells, HeLa cells, MDCK cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human colon tissue, human hepatocellular carcinomaNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells, MCF-7 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information RAB10 is a member of the RAB family of small GTPases, which are key regulators of vesicular trafficking. RAB proteins are cyclically controlled, requiring a GDP-GTP exchange that is facilitated by RAB guanine nucleotide exchange factors. Rab10 plays essential functional roles in development: mice are embryonic lethal when both alleles are deleted. In addition, RAB10 plays a role in maintenance and regulation of endoplasmic reticulum (ER) morphology. RAB10 function has also been linked to neuronal morphology and polarization, playing a critical role in axonal development and dendrite arborization. Specification Tested Reactivity: human, mouse, rat, canine Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25830 Product name: Recombinant human RAB10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-200 aa of BC000896 Sequence: RVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC Predict reactive species Full Name: RAB10, member RAS oncogene family Calculated Molecular Weight: 200 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC000896 Gene Symbol: RAB10 Gene ID (NCBI): 10890 RRID: AB_2880752 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61026 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924