Proteintech, 27096-1-AP, Integrin Alpha V Polyclonal antibody

Size: 20ul / 150ul The Integrin Alpha V (27096-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin Alpha V in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 27096-1-AP targets Integrin Alpha V in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HUVEC cells, A549 cells, MCF-7 cells, human placenta tissue Positive IHC detected in: human Hepatocellular carcinoma, human breast cancer tissue, human liver cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Positive FC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin alpha V, also known as CD51, is a type I transmembrane glycoprotein composed of an extracellular domain, a transmembrane region and cytoplasmic domain (PMID: 2430295; 1690718). It can form heterodimers with one of the five beta integrin subunits (beta 1, 3, 5, 6, 8) that recognize ligands containing the sequence Arg-Gly-Asp, such as vitronectin, fibronectin, and osteopontin (PMID: 37087799). Integrin alpha V mainly plays a role in extracellular matrix-mediated cell adhesion and migration, differentiation, wound healing, inflammation, tumorigenesis, proliferation, angiogenesis, and metastasis. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25825 Product name: Recombinant human ITGAV protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 819-915 aa of BC136442 Sequence: SFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQ Predict reactive species Full Name: integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) Calculated Molecular Weight: 1048 aa, 116 kDa Observed Molecular Weight: 120-130 kDa, 27 kDa GenBank Accession Number: BC136442 Gene Symbol: Integrin alpha V Gene ID (NCBI): 3685 RRID: AB_2880753 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P06756 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.