Proteintech, 27098-1-AP, ECHDC3 Polyclonal antibody

Size: 20ul / 150ul The ECHDC3 (27098-1-AP) by Proteintech is a Polyclonal antibody targeting ECHDC3 in WB, IHC, ELISA applications with reactivity to human, canine samples 27098-1-AP targets ECHDC3 in WB, IHC, ELISA applications and shows reactivity with human, canine samples. Tested Applications Positive WB detected in: MDCK cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25707 Product name: Recombinant human ECHDC3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 29-303 aa of BC009617 Sequence: RFCSRDPAGAGRRESEPRPTSARQLDGIRNIVLSNPKKRNTLSLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDYHAEVFQTCSKVMMHIRNHPVPVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSHEPV Predict reactive species Full Name: enoyl Coenzyme A hydratase domain containing 3 Observed Molecular Weight: 33 kDa GenBank Accession Number: BC009617 Gene Symbol: ECHDC3 Gene ID (NCBI): 79746 RRID: AB_3085926 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96DC8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.