Iright
BRAND / VENDOR: Proteintech

Proteintech, 27100-1-AP, FGF3 Polyclonal antibody

CATALOG NUMBER: 27100-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FGF3 (27100-1-AP) by Proteintech is a Polyclonal antibody targeting FGF3 in IHC, ELISA applications with reactivity to human samples 27100-1-AP targets FGF3 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Fibroblast growth factor 3 (FGF3), belonging to the family of fibroblast growth factors (FGFs), It regulates several developmental processes, including brain patterning, branching morphogenesis and limb development, by binding, dimerizing and activating cell surface FGF receptors (FGFRs). It is required for normal ear development. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25361 Product name: Recombinant human FGF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 173-239 aa of BC113739 Sequence: QKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH Predict reactive species Full Name: fibroblast growth factor 3 (murine mammary tumor virus integration site (v-int-2) oncogene homolog) GenBank Accession Number: BC113739 Gene Symbol: FGF3 Gene ID (NCBI): 2248 RRID: AB_2880755 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P11487 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924