Proteintech, 27113-1-AP, KCNK4 Polyclonal antibody

Size: 20ul / 150ul The KCNK4 (27113-1-AP) by Proteintech is a Polyclonal antibody targeting KCNK4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 27113-1-AP targets KCNK4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, rat eye tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25931 Product name: Recombinant human KCNK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 261-393 aa of BC033577 Sequence: SRRTRAEMGGLTAQAASWTGTVTARVTQRAGPAAPPPEKEQPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSERGCPLPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV Predict reactive species Full Name: potassium channel, subfamily K, member 4 Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC033577 Gene Symbol: KCNK4 Gene ID (NCBI): 50801 RRID: AB_2880761 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYG8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.