Proteintech, 27117-1-AP, PTN Polyclonal antibody

Size: 20ul / 150ul The PTN (27117-1-AP) by Proteintech is a Polyclonal antibody targeting PTN in WB, IHC, ELISA applications with reactivity to human samples 27117-1-AP targets PTN in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: fetal human brain tissue, U-87 MG cells Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Pleiotrophin (PTN) is a multifunctional, cationic, glycosaminoglycan-binding cytokine and growth factor involved in numerous physiological and pathological processes, including tissue repair and inflammation-related diseases. PTN is highly upregulated in the brain in different disorders characterized by overt neuroinflammation such as neurodegenerative diseases, drug addiction, traumatic injury, and ischemia. PTN is important for CNS repair and for survival and differentiation of dopaminergic neurons. Specification Tested Reactivity: human Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26004 Product name: Recombinant human PTN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 94-168 aa of BC005916 Sequence: QFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD Predict reactive species Full Name: pleiotrophin Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 17-19 kDa GenBank Accession Number: BC005916 Gene Symbol: PTN Gene ID (NCBI): 5764 RRID: AB_2880763 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21246 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.