Iright
BRAND / VENDOR: Proteintech

Proteintech, 27120-1-AP, eNOS Polyclonal antibody

CATALOG NUMBER: 27120-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The eNOS (27120-1-AP) by Proteintech is a Polyclonal antibody targeting eNOS in WB, ELISA applications with reactivity to human, mouse samples 27120-1-AP targets eNOS in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: bEnd.3 cells, HUVEC cells, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Endothelial NOS(eNOS), also known as nitric oxide synthase 3(NOS3), has a protective function in the cardiovascular system, which is attributed to NO production. NOS3 has 3 isoforms of 68, 69, 133 kDa. Polymorphisms in NOS3 gene affects the susceptibility to several diseases such as hypertension, preeclampsia, diabetes mellitus, obesity, erectile dysfunction, and migraine. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25712 Product name: Recombinant human NOS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of Sequence: MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLTQPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP Predict reactive species Full Name: nitric oxide synthase 3 (endothelial cell) Observed Molecular Weight: 133 kDa, 69 kDa Gene Symbol: eNOS Gene ID (NCBI): 4846 RRID: AB_2880764 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P29474 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924