Proteintech, 27134-1-AP, C9orf142 Polyclonal antibody

Size: 20ul / 150ul The C9orf142 (27134-1-AP) by Proteintech is a Polyclonal antibody targeting C9orf142 in WB, IHC, ELISA applications with reactivity to human samples 27134-1-AP targets C9orf142 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24910 Product name: Recombinant human C9orf142 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC002613 Sequence: MDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLAALKARFGLSAAEDITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET Predict reactive species Full Name: chromosome 9 open reading frame 142 Observed Molecular Weight: 22 kDa GenBank Accession Number: BC002613 Gene Symbol: C9orf142 Gene ID (NCBI): 286257 RRID: AB_2880769 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BUH6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.