Product Description
Size: 20ul / 150ul
The PR3/PRTN3 (27153-1-AP) by Proteintech is a Polyclonal antibody targeting PR3/PRTN3 in WB, IHC, ELISA applications with reactivity to human samples
27153-1-AP targets PR3/PRTN3 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: human spleen tissue, human placenta tissue
Positive IHC detected in: human spleen tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:200-1:800
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25915 Product name: Recombinant human PRTN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 89-150 aa of BC096183 Sequence: NVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGT Predict reactive species
Full Name: proteinase 3
Calculated Molecular Weight: 256 aa, 28 kDa
Observed Molecular Weight: 28 kDa
GenBank Accession Number: BC096183
Gene Symbol: PRTN3
Gene ID (NCBI): 5657
RRID: AB_2880777
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P24158
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924