Iright
BRAND / VENDOR: Proteintech

Proteintech, 27157-1-AP, ZFPL1 Polyclonal antibody

CATALOG NUMBER: 27157-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZFPL1 (27157-1-AP) by Proteintech is a Polyclonal antibody targeting ZFPL1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 27157-1-AP targets ZFPL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The ZFPL1 protein is a zinc finger protein localized to the Golgi apparatus, and its function is closely associated with maintaining Golgi structural integrity. Research indicates that ZFPL1 interacts with the Golgi matrix protein GM130 through its N-terminal domain, and this interaction is crucial for the proper anchoring of GM130 to the Golgi. When ZFPL1 expression is suppressed, GM130 dissociates from the membrane, leading to the fragmentation of the Golgi ribbon structure and significantly impairing protein secretion and transport processes. Therefore, ZFPL1 is considered a key scaffolding protein essential for maintaining the normal structure and function of the Golgi apparatus. Currently, its specific role in highly polarized cells with active secretory functions, such as neurons, is a major focus in the field. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24097 Product name: Recombinant human ZFPL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-264 aa of BC012814 Sequence: MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNIPLASRETTRLVCYDLFHWACLNERAAQLPRNTAPAGYQCPSCNGPIFPPTNLAGPVASALREKLATVNWARAGLGLPLIDEVVSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFYSQAPRPPASPGRPEQHTVIHMGNPEPLTHAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPALGWLARLLRSRAGSRKRPLTLLQR Predict reactive species Full Name: zinc finger protein-like 1 Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC012814 Gene Symbol: ZFPL1 Gene ID (NCBI): 7542 RRID: AB_2880781 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95159 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924