Product Description
Size: 20ul / 150ul
The GJB5 (27166-1-AP) by Proteintech is a Polyclonal antibody targeting GJB5 in IP, ELISA applications with reactivity to human, mouse samples
27166-1-AP targets GJB5 in IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive IP detected in: mouse skin tissue
Recommended dilution
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Background Information
GJB5, also known as Connexin31.1, is a connexin subtype associated with apoptosis in organs such as the eye and ovary; it is not highly expressed in many tissues in normal conditions (PMID:32592185).
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26052 Product name: Recombinant human GJB5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-273 aa of BC004379 Sequence: KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLLPDRPRDHVKKTIL Predict reactive species
Full Name: gap junction protein, beta 5, 31.1kDa
Calculated Molecular Weight: 31 kDa
Observed Molecular Weight: 28 kDa
GenBank Accession Number: BC004379
Gene Symbol: GJB5
Gene ID (NCBI): 2709
RRID: AB_3085930
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O95377
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924