Proteintech, 27173-1-AP, PLCG2 Polyclonal antibody

Size: 20ul / 150ul The PLCG2 (27173-1-AP) by Proteintech is a Polyclonal antibody targeting PLCG2 in WB, IHC, ELISA applications with reactivity to human samples 27173-1-AP targets PLCG2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Raji cells, Ramos cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25847 Product name: Recombinant human PLCG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 826-928 aa of BC007565 Sequence: DISTADFEELEKQIIEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGYPPVEFATDRVEELFEWFQSIREITWKIDTKENNMKYWEKNQSIAI Predict reactive species Full Name: phospholipase C, gamma 2 (phosphatidylinositol-specific) Calculated Molecular Weight: 148 kDa Observed Molecular Weight: 148 kDa GenBank Accession Number: BC007565 Gene Symbol: PLCG2 Gene ID (NCBI): 5336 RRID: AB_2880785 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P16885 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.