Proteintech, 27174-1-AP, TMIGD1 Polyclonal antibody

Size: 20ul / 150ul The TMIGD1 (27174-1-AP) by Proteintech is a Polyclonal antibody targeting TMIGD1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 27174-1-AP targets TMIGD1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, Daudi cells, HUVEC cells, Raji cells Positive IHC detected in: mouse kidney tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat small intestine tissue, mouse small intestine tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information TMIGD1 (Transmembrane and immunoglobulin domain containing 1) is involved in various cellular processes such as regulation of cell structure, cell-cell adhesion, and cellular movement. It protects cells from oxidative- and nutrient-deprivation-induced cell injury by stabilizing the transepithelial electric resistance and permeability of renal epithelial cells. TMIGD1 has a calculated molecular mass of 29 kDa, and can be detected as 45 kDa due to the N-glycosylation (PMID: 26342724). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25691 Product name: Recombinant human TMIGD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 133-207 aa of BC137201 Sequence: VEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLD Predict reactive species Full Name: transmembrane and immunoglobulin domain containing 1 Calculated Molecular Weight: 262 aa, 29 kDa Observed Molecular Weight: 45 kDa, 29 kDa GenBank Accession Number: BC137201 Gene Symbol: TMIGD1 Gene ID (NCBI): 388364 RRID: AB_2880786 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UXZ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.